PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29916.m000544
Common NameRCOM_1062060
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 787aa    MW: 86369.7 Da    PI: 6.7951
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29916.m000544genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS315.11.6e-964267862374
           GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                     ++L+++Ae v +g+++ aq +Larl+++ sp g+p++R+a+yf+eAL+  l+   ++ + +lpp++ ++ +++ +l a+k+fsevsP+++f ++t
  29916.m000544 426 LDQLYKAAELVGTGNFSHAQGILARLNQQLSPIGKPLHRAAFYFKEALQLLLLM-NNNPVTSLPPRSPTPFDVIFKLGAYKVFSEVSPLIQFVNFT 520
                    679*************************************************98.555556799999999************************** PP

           GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrle..dlel 191
                    +Nqa+lea+++++r+HiiDfdi+ G+QW++++q+L  R++g+psl+iT+++sp++++  e+  ++e+L++fA+e+g++fe +v+  ++le  + +l
  29916.m000544 521 CNQALLEALSEADRIHIIDFDIGFGAQWASFMQELP-RNRGAPSLKITAFASPSTHHPVEVLLMRENLTQFANEIGISFELDVINFDSLEqsCYSL 615
                    ***********************************6.789*******************************************9777655115678 PP

           GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEr 287
                      +r k++Ea+aV++ +   +  +++++l+s    +L++vk+lsPk+vv  ++  d+++ +F +++l+al+ +  l++sl+a    +s++ +k+E+
  29916.m000544 616 PIFRSKENEAIAVHFPV--WSASNQPAALPS----LLRFVKQLSPKIVVSLDRG-DRTDLPFPQHILHALQSHILLLESLDAV-NVASDAVNKIEK 703
                    8889999*******999..556667888888....****************995.778**********************665.56999******* PP

           GRAS 288 ellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                    +ll+++i++ v  + ++      ++ +W+  + +aGF+pv++s+++++qa++++++++++g++ve++++slvl+W++r L+s+SaWr
  29916.m000544 704 FLLQPRIESTVLGRLRA----PDKMPTWKTIFASAGFSPVTFSNFTETQAECVVKRTPVRGFHVEKRQASLVLCWQRRDLISASAWR 786
                    ************99998....999**************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.146399766IPR005202Transcription factor GRAS
PfamPF035145.4E-94426786IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 787 aa     Download sequence    Send to blast
MELERGDVDN MELKKKRKNK GKGGLDIVDI ATFASICAQQ ETWKQKQQLQ QQEVNSFAST  60
EPTSVLHMRR SPSPPTSAST LSSSFNNGGG GGNSTDNTTT TATEKVVNPL NNERKDEWAT  120
ELQPIPSGLE ISAGERCGVG LEDWENMFSE PNQEQSLLRW IAGDVDESFG LRQLLQGGNN  180
PGEFDGNGTA GLGIVDHAPG FEAMTAIASG VSSIATNLSS FPTSGYSSIT SGSNNGNGKL  240
GSCLVSPPSS SFTSGSVNFI SVGLGSNSSS NCSIQNPIFG SSPSSVSLPG ALPPGMVYHH  300
NLQHQIEAPE EKPQILNPQV LMNQQQSQNS NFFLPLPFPQ QENHLLQPQT KRHNSGGMDP  360
MPQMISKLPF SDPGYELLLR KQQHMGFQQG VHFLHPHLQQ KPLVVKKEVG GGHQQQQQAQ  420
HQHALLDQLY KAAELVGTGN FSHAQGILAR LNQQLSPIGK PLHRAAFYFK EALQLLLLMN  480
NNPVTSLPPR SPTPFDVIFK LGAYKVFSEV SPLIQFVNFT CNQALLEALS EADRIHIIDF  540
DIGFGAQWAS FMQELPRNRG APSLKITAFA SPSTHHPVEV LLMRENLTQF ANEIGISFEL  600
DVINFDSLEQ SCYSLPIFRS KENEAIAVHF PVWSASNQPA ALPSLLRFVK QLSPKIVVSL  660
DRGDRTDLPF PQHILHALQS HILLLESLDA VNVASDAVNK IEKFLLQPRI ESTVLGRLRA  720
PDKMPTWKTI FASAGFSPVT FSNFTETQAE CVVKRTPVRG FHVEKRQASL VLCWQRRDLI  780
SASAWRC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-2844478622375GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11219LKKKRKNK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015580706.10.0PREDICTED: scarecrow-like protein 27
TrEMBLB9SSH10.0B9SSH1_RICCO; Putative uncharacterized protein
STRINGPOPTR_0003s11020.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF132692130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-120GRAS family protein